Here are some instructions on how to set up BLAST on your local machine (as opposed to run it at NCBI on the web). It is useful if you have lots of sequences to BLAST or if you want to manipulate its output for easier processing downstream.
I included a short presentation on BLAST and the syntax of its run, as well as an example query and a database (see details below) so that you could try it yourself. What I do not cover in these instructions is how to prepare a custom BLAST database from your sequences (if you can't rely on ready-made databases at NCBI), but it is covered in section 7 of the description of BLAST databases from NCBI (included here in full, below).
Apparently, as of September 2018, the local version of BLAST has a function that behaves differently from the identically named function in the online version of BLAST. Option -max_target_seqs
specifies N number of sequences returned in the output. In the local BLAST, it simply returns the N hits above the e value threshold, irrespectively of the BLAST score or the actual e value. In the online version of the BLAST, the same function returns the N top hits by score (which is what many people assume it should do). This has been very recently reported by Shah N. et al. in Misunderstood parameter of NCBI BLAST impacts the correctness of bioinformatics workflows. See also post by Peter Cock What BLAST's max-target-sequences doesn't do and Sujai Kumar's report at Github for a bit more nuanced description of the behaviour. I also note that Peter's and Sujai's report do not suggest a different behaviour between online and local versions of the BLAST.
In my guidelines below, the local BLAST is run with -max_target_seqs
set to 1. Contrary to my assumption, it does not necessarily return the best hit. As this behaviour is still being investigated, the safest solution currently is to run your local blast several times, with -max_target_seqs
set to different values (depending on the size of your database) and then rank the output by score and e value for every query ID. Proceed with caution.
-
Standalone BLAST Setup for Unix - BLAST® Help - NCBI Bookshelf
-
Standalone BLAST Setup for Windows PC - BLAST® Help - NCBI Bookshelf
The query for this exercise is a list of 32162 sequences of all unique oligonucleotide probes from Agilent's D. melanogaster gene expression microarray in a multi-fasta format. The query is included in this repository directly and is called blast_query.tar.gz
. Uncompressed file is 2.4 MB. Download the query and unzip it into a folder (let's call the folder blast_pratice
for the purpose of this exercise).
The database contains list of all known and predicted transcripts from D. melanogaster in the Ensembl format, as downloaded in March 2017. The database is available to download from Figshare and the compressed file is approximately 100 MB. Download it and unzip into the blast_practice
folder - it will unzip into its own folder called Dmel_transcripts_Ensembl
.
I originally created the database to map Agilent probes against known and predicted transcripts to eliminate probes that do not align well. I used this data in the Bryk et al. 2017 paper Transcriptional effects of a positive feedback circuit in Drosophila melanogaster. If I have some time, I may reduce both the queries and the database for easier sharing and downloading.
If you want to download BLAST databases yourself, the best way to do it is to use NCBI's ftp server. I created a little video guide on how to download BLAST executables and databases: it is available on Figshare.
To run the BLAST (assuming it is installed), enter the blast_practice
folder and run a megablast of the query against the database with the following command:
blastn -task megablast -db Dmel_transcripts_Ensembl/Dmel_genes_all.fa -query blast_query.txt -dust no -max_target_seqs 1 -outfmt "6 qseqid sseqid evalue pident stitle" -out outputfile.txt
The various options are explained in the presentation and in the section BLAST options below.
-
BLAST® Command Line Applications User Manual - NCBI Bookshelf
-
BLAST+ features - BLAST® Command Line Applications User Manual - NCBI Bookshelf
This is copied directly from the NCBI website and it was up to date as of March 6th, 2017.
The BLAST Databases Last updated on March 6, 2017 This document describes the BLAST databases available on the NCBI FTP site under the /blast/db directory. The direct URL is ftp://ftp.ncbi.nlm.nih.gov/blast/db 1. Quick Start * Get all numbered files for a database with the same base name: Each of these files represents a subset (volume) of that database, and all of them are needed to reconstitute the database. * After extraction, there is no need to concatenate the resulting files: Call the database with the base name, for nr database files, use "-db nr". * For easy download, use the update_blastdb.pl script from the blast+ package. * Incremental update is not available. 2. General Introduction BLAST search pages under the Basic BLAST section of the NCBI BLAST home page (http://blast.ncbi.nlm.nih.gov/) use a standard set of BLAST databases for nucleotide, protein, and translated BLAST searches. These databases are made available as compressed archives of pre-formatted form) and can be donwloaded from the /db directory of the BLAST ftp site (ftp://ftp.ncbi.nlm.nih.gov/blast/db/). The FASTA files reside under the /FASTA subdirectory. The pre-formatted databases offer the following advantages: * Pre-formatting removes the need to run makeblastdb; * Species-level taxonomy ids are included for each database entry; * Databases are broken into smaller-sized volumes and are therefore easier to download; * Sequences in FASTA format can be generated from the pre-formatted databases by using the blastdbcmd utility; * A convenient script (update_blastdb.pl) is available in the blast+ package to download the pre-formatted databases. Pre-formatted databases must be downloaded using the update_blastdb.pl script or via FTP in binary mode. Documentation for this script can be obtained by running the script without any arguments; Perl installation is required. The compressed files downloaded must be inflated with gzip or other decompress tools. The BLAST database files can then be extracted out of the resulting tar file using the tar utility on Unix/Linux, or WinZip and StuffIt Expander on Windows and Macintosh platforms, respectively. Large databases are formatted in multiple one-gigabyte volumes, which are named using the basename.##.tar.gz convention. All volumes with the same base name are required. An alias file is provided to tie individual volumes together so that the 8000 database can be called using the base name (without the .nal or .pal extension). For example, to call the est database, simply use "-db est" option in the command line (without the quotes). Additional BLAST databases that are not provided in pre-formatted formats may be available in the FASTA subdirectory. For other genomic BLAST databases, please check the genomes ftp directory at: ftp://ftp.ncbi.nlm.nih.gov/genomes/ 3. Contents of the /blast/db/ directory The pre-formatted BLAST databases are archived in this directory. The names of these databases and their contents are listed below. +-----------------------------+------------------------------------------------+ File Name | Content Description +-----------------------------+------------------------------------------------+ 16SMicrobial.tar.gz | Bacterial and Archaeal 16S rRNA sequences from BioProjects 33175 and 33117 FASTA/ | Subdirectory for FASTA formatted sequences README | README for this subdirectory (this file) Representative_Genomes.*tar.gz| Representative bacterial/archaeal genomes database cdd_delta.tar.gz | Conserved Domain Database sequences for use with stand alone deltablast cloud/ | Subdirectory of databases for BLAST AMI; see http://1.usa.gov/TJAnEt env_nr.*tar.gz | Protein sequences for metagenomes env_nt.*tar.gz | Nucleotide sequences for metagenomes est.tar.gz | This file requires est_human.*.tar.gz, est_mouse.*.tar.gz, and est_others.*.tar.gz files to function. It contains the est.nal alias so that searches against est (-db est) will include est_human, est_mouse and est_others. est_human.*.tar.gz | Human subset of the est database from the est division of GenBank, EMBL and DDBJ. est_mouse.*.tar.gz | Mouse subset of the est databasae est_others.*.tar.gz | Non-human and non-mouse subset of the est database gss.*tar.gz | Sequences from the GSS division of GenBank, EMBL, and DDBJ htgs.*tar.gz | Sequences from the HTG division of GenBank, EMBL, and DDBJ human_genomic.*tar.gz | Human RefSeq (NC_### ##) chromosome records with gap adjusted concatenated NT_ contigs nr.*tar.gz | Non-redundant protein sequences from GenPept, Swissprot, PIR, PDF, PDB, and NCBI RefSeq nt.*tar.gz | Partially non-redundant nucleotide sequences from all traditional divisions of GenBank, EMBL, and DDBJ excluding GSS,STS, PAT, EST, HTG, and WGS. other_genomic.*tar.gz | RefSeq chromosome records (NC_### ##) for non-human organisms pataa.*tar.gz | Patent protein sequences patnt.*tar.gz | Patent nucleotide sequences. Both patent databases are directly from the USPTO, or from the EPO/JPO via EMBL/DDBJ pdbaa.*tar.gz | Sequences for the protein structure from the Protein Data Bank pdbnt.*tar.gz | Sequences for the nucleotide structure from the Protein Data Bank. They are NOT the protein coding sequences for the corresponding pdbaa entries. refseq_genomic.*tar.gz | NCBI genomic reference sequences refseq_protein.*tar.gz | NCBI protein reference sequences refseq_rna.*tar.gz | NCBI Transcript reference sequences sts.*tar.gz | Sequences from the STS division of GenBank, EMBL, and DDBJ swissprot.tar.gz | Swiss-Prot sequence database (last major update) taxdb.tar.gz | Additional taxonomy information for the databases listed here | providing common and scientific names tsa_nt.*tar.gz | Sequences from the TSA division of GenBank, EMBL, and DDBJ vector.tar.gz | Vector sequences from 2010, see Note 2 in section 4. +-----------------------------+------------------------------------------------+ 4. Contents of the /blast/db/FASTA directory This directory contains FASTA formatted sequence files. The file names and database contents are listed below. These files must be unpacked and processed through blastdbcmd before they can be used by the BLAST programs. +-----------------------+-----------------------------------------------------+ |File Name | Content Description | +-----------------------+-----------------------------------------------------+ alu.a.gz | translation of alu.n repeats alu.n.gz | alu repeat elements (from 2003) drosoph.aa.gz | CDS translations from drosophila.nt drosoph.nt.gz | genomic sequences for drosophila (from 2003) env_nr.gz* | Protein sequences for metagenomes, taxid 408169 env_nt.gz* | Nucleotide sequences for metagenomes, taxid 408169 est_human.gz* | human subset of the est database (see Note 1) est_mouse.gz* | mouse subset of the est database est_others.gz* | non-human and non-mouse subset of the est database gss.gz* | sequences from the GSS division of GenBank, EMBL, and DDBJ htgs.gz* | sequences from the HTG division of GenBank, EMBL, and DDBJ human_genomic.gz* | human RefSeq (NC_### ##) chromosome records with gap adjusted concatenated NT_ contigs igSeqNt.gz | human and mouse immunoglobulin variable region nucleotide sequences igSeqProt.gz | human and mouse immunoglobulin variable region protein sequences mito.aa.gz | CDS translations of complete mitochondrial genomes mito.nt.gz | complete mitochondrial genomes nr.gz* | non-redundant protein sequence database with entries from GenPept, Swissprot, PIR, PDF, PDB, and RefSeq nt.gz* | nucleotide sequence database, with entries from all traditional divisions of GenBank, EMBL, and DDBJ; excluding bulk divisions (gss, sts, pat, est, htg) and wgs entries. Partially non-redundant. other_genomic.gz* | RefSeq chromosome records (NC_### ##) for organisms other than human pataa.gz* | patent protein sequences patnt.gz* | patent nucleotide sequences. Both patent sequence files are from the USPTO, or EPO/JPO via EMBL/DDBJ pdbaa.gz* | protein sequences from pdb protein structures pdbnt.gz* | nucleotide sequences from pdb nucleic acid structures. They are NOT the protein coding sequences for the corresponding pdbaa entries. sts.gz* | database for sequence tag site entries swissprot.gz* | swiss-prot database (last major release) vector.gz | vector sequences from 2010. (See Note 2) yeast.aa.gz | protein translations from yeast.nt yeast.nt.gz | yeast genomes (from 2003) +-----------------------+---------------------------------------------------+ NOTE: (1) NCBI does not provide the complete est database in FASTA format. One needs to get all three subsets (est_human, est_mouse, and est_others and concatenate them into the complete est fasta database). (2) For screening for vector contamination, use the UniVec database: ftp://ftp.ncbi.nlm.nih.gov/pub/UniVec/ * marked files have pre-formatted counterparts. 5. Database updates The BLAST databases are updated regularly. There is no established incremental update scheme. We recommend downloading the complete databases regularly to keep their content current. 6. Non-redundant defline syntax The non-redundant databases are nr, nt and pataa. Identical sequences are merged into one entry in these databases. To be merged two sequences must have identical lengths and every residue at every position must be the same. The FASTA deflines for the different entries that belong to one record are separated by control-A characters invisible to most programs. In the example below both entries Q57293.1 and AAB05030.1 have the same sequence, in every respect: >Q57293.1 RecName: Full=Fe(3+) ions import ATP-binding protein FbpC ^AAAB05030.1 afuC [Actinobacillus pleuropneumoniae] ^AAAB17216.1 afuC [Actinobacillus pleuropneumoniae] MNNDFLVLKNITKSFGKATVIDNLDLVIKRGTMVTLLGPSGCGKTTVLRLVAGLENPTSGQIFIDGEDVTKSSIQNRDIC IVFQSYALFPHMSIGDNVGYGLRMQGVSNEERKQRVKEALELVDLAGFADRFVDQISGGQQQRVALARALVLKPKVLILD EPLSNLDANLRRSMREKIRELQQRLGITSLYVTHDQTEAFAVSDEVIVMNKGTIMQKARQKIFIYDRILYSLRNFMGEST ICDGNLNQGTVSIGDYRFPLHNAADFSVADGACLVGVRPEAIRLTATGETSQRCQIKSAVYMGNHWEIVANWNGKDVLIN ANPDQFDPDATKAFIHFTEQGIFLLNKE Individual sequences are now identifed simply by their accession.version. For databases whose entries are not from official NCBI sequence databases, such as Trace database, the gnl| convention is used. For custom databases, this convention should be followed and the id for each sequence must be unique, if one would like to take the advantage of indexed database, which enables specific sequence retrieval using blastdbcmd program included in the blast executable package. One should refer to documents distributed in the standalone BLAST package for more details. 7. Formatting a FASTA file into a BLASTable database FASTA files need to be formatted with makeblastdb before they can be used in local blast search. For those from NCBI, the following makeblastdb commands are recommended: For nucleotide fasta file: makeblastdb -in input_db -dbtype nucl -parse_seqids For protein fasta file: makeblastdb -in input_db -dbtype prot -parse_seqids In general, if the database is available as BLAST database, it is better to use the preformatted database. 8. Technical Support Questions and comments on this document and NCBI BLAST related questions should be sent to the blast-help group at: blast-help@ncbi.nlm.nih.gov For information about other NCBI resources/services, please send email to NCBI User Service at: info@ncbi.nlm.nih.gov
DESCRIPTION
Nucleotide-Nucleotide BLAST 2.2.31+
USAGE
blastn [-h] [-help] [-import_search_strategy filename] [-export_search_strategy filename] [-task task_name] [-db database_name] [-dbsize num_letters] [-gilist filename] [-seqidlist filename] [-negative_gilist filename] [-entrez_query entrez_query] [-db_soft_mask filtering_algorithm] [-db_hard_mask filtering_algorithm] [-subject subject_input_file] [-subject_loc range] [-query input_file] [-out output_file] [-evalue evalue] [-word_size int_value] [-gapopen open_penalty] [-gapextend extend_penalty] [-perc_identity float_value] [-qcov_hsp_perc float_value] [-max_hsps int_value] [-xdrop_ungap float_value] [-xdrop_gap float_value] [-xdrop_gap_final float_value] [-searchsp int_value] [-sum_stats bool_value] [-penalty penalty] [-reward reward] [-no_greedy] [-min_raw_gapped_score int_value] [-template_type type] [-template_length int_value] [-dust DUST_options] [-filtering_db filtering_database] [-window_masker_taxid window_masker_taxid] [-window_masker_db window_masker_db] [-soft_masking soft_masking] [-ungapped] [-culling_limit int_value] [-best_hit_overhang float_value] [-best_hit_score_edge float_value] [-window_size int_value] [-off_diagonal_range int_value] [-use_index boolean] [-index_name string] [-lcase_masking] [-query_loc range] [-strand strand] [-parse_deflines] [-outfmt format] [-show_gis] [-num_descriptions int_value] [-num_alignments int_value] [-line_length line_length] [-html] [-max_target_seqs num_sequences] [-num_threads int_value] [-remote] [-version]
OPTIONAL ARGUMENTS
-h
Print USAGE and DESCRIPTION; ignore all other parameters-help
Print USAGE, DESCRIPTION and ARGUMENTS; ignore all other parameters-version
Print version number; ignore other arguments
-query <File_In>
Input file name; Default = '-'-query_loc <String>
Location on the query sequence in 1-based offsets (Format: start-stop)-strand <String, 'both', 'minus', 'plus'>
Query strand(s) to search against database/subject; Default = 'both'
-task <String, Permissible values: 'blastn' 'blastn-short' 'dc-megablast' 'megablast' 'rmblastn' >
Task to execute; Default =megablast
-db <String>
BLAST database name; Incompatible with:subject, subject_loc
-out <File_Out>
Output file name; Default = --
-evalue <Real>
Expectation value (E) threshold for saving hits; Default =10
-word_size <Integer, >=4>
Word size for wordfinder algorithm (length of best perfect match)-gapopen <Integer>
Cost to open a gap-gapextend <Integer>
Cost to extend a gap-penalty <Integer, <=0>
Penalty for a nucleotide mismatch-reward <Integer, >=0>
Reward for a nucleotide match-use_index <Boolean>
Use MegaBLAST database index; Default =false
-index_name <String>
MegaBLAST database index name
-subject <File_In>
Subject sequence(s) to search; Incompatible with:db, gilist, seqidlist, negative_gilist, db_soft_mask, db_hard_mask
-subject_loc <String>
Location on the subject sequence in 1-based offsets (Format: start-stop); Incompatible with:db, gilist, seqidlist, negative_gilist, db_soft_mask, db_hard_mask, remote
-outfmt <String>
alignment view options:0
= pairwise,1
= query-anchored showing identities,2
= query-anchored no identities,3
= flat query-anchored, show identities,4
= flat query-anchored, no identities,5
= XML Blast output,6
= tabular,7
= tabular with comment lines,8
= Text ASN.1,9
= Binary ASN.1,10
= Comma-separated values,11
= BLAST archive format (ASN.1),12
= JSON Seqalign output,13
= JSON Blast output,14
= XML2 Blast output
Options 6
, 7
, and 10
can be additionally configured to produce a custom format specified by space delimited format specifiers. The supported format specifiers are:
-outfmt <String>
qseqid
means Query Seq-idqgi
means Query GIqacc
means Query accesionqaccver
means Query accesion.versionqlen
means Query sequence lengthsseqid
means Subject Seq-idsallseqid
means All subject Seq-id(s), separated by a ';'sgi
means Subject GIsallgi
means All subject GIssacc
means Subject accessionsaccver
means Subject accession.versionsallacc
means All subject accessionsslen
means Subject sequence lengthqstart
means Start of alignment in queryqend
means End of alignment in querysstart
means Start of alignment in subjectsend
means End of alignment in subjectqseq
means Aligned part of query sequencesseq
means Aligned part of subject sequencevalue
means Expect valuebitscore
means Bit scorescore
means Raw scorelength
means Alignment lengthpident
means Percentage of identical matchesnident
means Number of identical matchesmismatch
means Number of mismatchespositive
means Number of positive-scoring matchesgapopen
means Number of gap openingsgaps
means Total number of gapsppos
means Percentage of positive-scoring matchesframes
means Query and subject frames separated by a '/'qframe
means Query framesframe
means Subject framebtop
means Blast traceback operations (BTOP)staxids
means unique Subject Taxonomy ID(s), separated by a ';' (in numerical order)sscinames
means unique Subject Scientific Name(s), separated by a ';'scomnames
means unique Subject Common Name(s), separated by a ';'blastnames
means unique Subject Blast Name(s), separated by a ';' (in alphabetical order)sskingdoms
means unique Subject Super Kingdom(s), separated by a ';' (in alphabetical order)stitle
means Subject Titlesalltitles
means All Subject Title(s), separated by a '<>'sstrand
means Subject Strandqcovs
means Query Coverage Per Subjectqcovhsp
means Query Coverage Per HSPqcovus
is a measure of Query Coverage that counts a position in a subject sequence for this measure only once. The second time the position is aligned to the query is not counted towards this measure.
When - -outfmt
options are not specified, the default value is: qseqid sseqid pident length mismatch gapopen qstart qend sstart send evalue bitscore
, which is equivalent to the keyword std
.
-show_gis
Show NCBI GIs in deflines-num_descriptions <Integer, >=0>
Number of database sequences to show one-line descriptions for; Not applicable foroutfmt >4
; Default =500
; Incompatible with:max_target_seqs
-num_alignments <Integer, >=0>
Number of database sequences to show alignments for; Default =250
; Incompatible with:max_target_seqs
-line_length <Integer, >=1>
Line length for formatting alignments; Not applicable foroutfmt >4
; Default =60
-html
Produce HTML output
-dust <String>
Filter query sequence with DUST (Format: 'yes', 'level window linker', or 'no' to disable); Default =20 64 1
-filtering_db <String>
BLAST database containing filtering elements (i.e.: repeats)-window_masker_taxid <Integer>
Enable WindowMasker filtering using a Taxonomic ID-window_masker_db <String>
Enable WindowMasker filtering using this repeats database.-soft_masking <Boolean>
Apply filtering locations as soft masks Default = `true'- `-lcase_masking Use lower case filtering in query and subject sequence(s)?
-gilist <String>
Restrict search of database to list of GI's; Incompatible with:negative_gilist, seqidlist, remote, subject, subject_loc
-seqidlist <String>
Restrict search of database to list of SeqId's; Incompatible with:gilist, negative_gilist, remote, subject, subject_loc
-negative_gilist <String>
Restrict search of database to everything except the listed GIs; Incompatible with:gilist, seqidlist, remote, subject, subject_loc
-entrez_query <String>
Restrict search with the given Entrez query; Requires:remote
-db_soft_mask <String>
Filtering algorithm ID to apply to the BLAST database as soft masking; Incompatible with:db_hard_mask, subject, subject_loc
-db_hard_mask <String>
Filtering algorithm ID to apply to the BLAST database as hard masking; Incompatible with:db_soft_mask, subject, subject_loc
-perc_identity <Real, 0..100>
Percent identity-qcov_hsp_perc <Real, 0..100>
Percent query coverage per hsp-max_hsps <Integer, >=1>
Set maximum number of HSPs per subject sequence to save for each query-culling_limit <Integer, >=0>
If the query range of a hit is enveloped by that of at least this many higher-scoring hits, delete the hit; Incompatible with:best_hit_overhang, best_hit_score_edge
-best_hit_overhang <Real, (>0 and <0.5)>
Best Hit algorithm overhang value (recommended value: 0.1); Incompatible with:culling_limit
-best_hit_score_edge <Real, (>0 and <0.5)>
Best Hit algorithm score edge value (recommended value: 0.1); Incompatible with:culling_limit
-max_target_seqs <Integer, >=1>
Maximum number of aligned sequences to keep; Not applicable foroutfmt <=4
; Default =500
; Incompatible with:num_descriptions, num_alignments
Note: please see the comment on top of the page about the behaviour of this function
-template_type <String, coding, coding_and_optimal, optimal>
Discontiguous MegaBLAST template type; Requires:template_length
-template_length <Integer, Permissible values: 16, 18, 21>
Discontiguous MegaBLAST template length; Requires:template_type
-dbsize <Int8>
Effective length of the database-searchsp <Int8, >
=0>` Effective length of the search space-sum_stats <Boolean>
Use sum statistics
-import_search_strategy <File_In>
Search strategy to use; Incompatible with:export_search_strategy
-export_search_strategy <File_Out>
File name to record the search strategy used; Incompatible with:import_search_strategy
-xdrop_ungap <Real>
X-dropoff value (in bits) for ungapped extensions-xdrop_gap <Real>
X-dropoff value (in bits) for preliminary gapped extensions-xdrop_gap_final <Real>
X-dropoff value (in bits) for final gapped alignment-no_greedy
Use non-greedy dynamic programming extension-min_raw_gapped_score <Integer>
Minimum raw gapped score to keep an alignment in the preliminary gapped and traceback stages-ungapped
Perform ungapped alignment only-window_size <Integer, >=0>
Multiple hits window size, use 0 to specify 1-hit algorithm-off_diagonal_range <Integer, >=0>
Number of off-diagonals to search for the 2nd hit, use0
to turn off; Default =0
-parse_deflines
Should the query and subject defline(s) be parsed?-num_threads <Integer, >=1>
Number of threads (CPUs) to use in the BLAST search; Default =1
; Incompatible with:remote
-remote
Execute search remotely?; * Incompatible with:gilist, seqidlist, negative_gilist, subject_loc, num_threads